PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0019600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 427aa    MW: 45256.4 Da    PI: 5.9584
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0019600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09278335562
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                        kr +r   NR +A rs +RK  +i+eLe+kv+ L++e + L  +l +++  +a l ++
  ORGLA03G0019600.1 278 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATNLSAQLTMMQRDSAGLATQ 335
                        999***************************************9999988888777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15274338IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599276339IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.26E-11278329No hitNo description
PfamPF001701.7E-8278336IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-10278335No hitNo description
CDDcd147033.23E-22279330No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MNGGIGDALM QPQHVQVMSS SLPMVASTFV AEPAAAAANK PRAAGLPPTP PQVFAAQRAA  60
AAAGGDVCME ESAQGGGGGL PPRKAHRRSS SDVPFGYLAG QHQLLPPKVE AGWGHLGAGA  120
GGAAAADDLF NAYLNLEGLD GLNSSDDRHD EGDSRGSSIK TNGADSSENE SEECADDTRG  180
GIRLWSADGG ERREGVKRNA AGEPATAPLA RHARSLSMDS LIGKFNFTAG TAAAAGNGVA  240
LGPNRFSLEF GSGEFTPSEM KKIMADEKLA EMALADPKRV KRVLANRQSA ARSKERKMRY  300
IAELEQKVQI LQSEATNLSA QLTMMQRDSA GLATQNNELK FRLHAMEQQA QLRDALNEAL  360
TTEVQRLKLA TAELGDSCSS SSLAQQIQLN AQNQMFQLQQ QQATQIPFYQ LQQSQQNGAA  420
KNNESKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104620.0AC210462.1 Oryza glaberrima clone OG_BBa0033I09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.10.0PREDICTED: transcription factor RF2b-like
TrEMBLI1P7500.0I1P750_ORYGL; Uncharacterized protein
STRINGORGLA03G0019600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-87bZIP family protein